Skip to main content
Research notes

Sermorelin: Complete Guide to the GHRH(1-29) Peptide

Sermorelin is the synthetic, amidated 1-29 fragment of human growth-hormone-releasing hormone (GHRH), the shortest peptide that keeps the full intrinsic activity of the 44-amino-acid hormone. It prompts the pituitary to release its own growth hormone and is cleared within minutes, because the plasma enzyme dipeptidylpeptidase IV inactivates it. Marketed in the US as Geref, it was used to test for and treat growth-hormone deficiency in children, where trials showed faster growth, though less than with growth hormone itself; the manufacturer stopped production in 2008 and both US approvals were withdrawn in 2009. Adult studies were small and short, raised GH and sometimes IGF-1, and showed no consistent body-composition benefit; sermorelin has no EU authorisation and is prohibited in sport under WADA class S2.

11 min readUpdated 22 Sept 2026Reviewed by Independent EU laboratory (ISO/IEC 17025)
A dark Peptyds carton marked "Research Peptides, 5 MG" beside a vial labelled "Sermorelin, 5 MG," under an arched glass bead chain.
A dark Peptyds carton marked "Research Peptides, 5 MG" beside a vial labelled "Sermorelin, 5 MG," under an arched glass bead chain.
Jump to section
  1. 01What is sermorelin?
  2. 02What is the half-life of sermorelin?
  3. 03What did the Geref trials in children show?
  4. 04How was sermorelin used as a diagnostic test?
  5. 05Does sermorelin work in adults?
  6. 06What side effects were reported with sermorelin?
  7. 07Is sermorelin FDA-approved or authorised in the EU?
  8. 08How Peptyds frames sermorelin
  • Sermorelin is GHRH(1-29)-NH2: the amidated first 29 residues of growth-hormone-releasing hormone, with no amino-acid substitutions.
  • It prompts the pituitary to release its own growth hormone and is cleared in minutes, with a 4.3-minute disappearance half-time measured in healthy men.
  • As Geref it was used to diagnose and treat GH deficiency in children; growth improved, but less than with GH itself in a randomised comparison.
  • Adult studies were small and short: GH rose, IGF-1 rose inconsistently, and body composition did not change in the six-week nightly study.
  • Geref production stopped in 2008 and its US approvals were withdrawn in June 2009; sermorelin has no EU authorisation.
  • Sermorelin is named as a GHRH analogue on the WADA 2026 Prohibited List under S2.2.4.

Discussed in this guide

  • SermorelinA GHRH analogue studied for endogenous growth hormone stimulation — investigated in body-composition, sleep, and healthy-aging contexts.5 mg · 10 mg · 15 mg · 20 mg€6.75 / mgOut of stock

What is sermorelin?

Sermorelin is the synthetic, C-terminally amidated 1-29 fragment of human growth-hormone-releasing hormone (GHRH), also written GRF 1-29 or GHRH(1-29)-NH2. Its sequence, YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2, is identical to the first 29 residues of the natural hormone, with no substitutions. It acts on the GHRH receptor of the anterior pituitary and prompts the gland to release its own growth hormone (GH).[3][8]

The parent hormone was first isolated in 1982 not from the brain but from a pancreatic tumour that had caused acromegaly: a 44-amino-acid peptide whose synthetic copy stimulated GH secretion in vitro and in vivo. Deletion experiments soon showed that the hormone does not need its full length. In rat pituitary cells, the 29-residue amide kept about half the potency of the complete molecule; shorter fragments down to residue 21 were still active but far less potent, and activity disappeared at 1-19.[1][2]

That made GHRH(1-29)-NH2 the practical choice for a medicine: the shortest synthetic peptide with the full biological activity of GHRH, in the words of a 1999 drug review. Sermorelin is therefore the historical baseline of the GHRH-analogue family, the molecule against which later designs such as CJC-1295 and tesamorelin are compared.[8]

Continue reading:View Sermorelin

What is the half-life of sermorelin?

Minutes. Native GHRH is inactivated in plasma when dipeptidylpeptidase IV (DPP-IV) removes its first two amino acids; the resulting GHRH(3-44) retains less than a thousandth of the biological activity. After intravenous injection in healthy people, intact GHRH(1-44) had a half-life of 6.8 minutes. The shortened 1-29 amide is cut at the same bond, and it is also open to trypsin-like cleavage further along the chain.[4][5]

Human measurements of sermorelin itself agree. During constant intravenous infusion in ten healthy men, GHRH(1-29)-NH2 had a disappearance half-time of 4.3 minutes. In 30 healthy men it was eliminated rapidly after an intravenous injection, yet GH stayed elevated for about three hours, and its bioavailability through the nasal mucosa was only 3-5%. Its DPP-IV product, GHRH(3-29), has been detected in human plasma after a subcutaneous dose.[6][7][3]

The short plasma life is the design problem that later analogues set out to solve. A D-alanine at position 2 lengthened the half-time only modestly, to 6.7 minutes; CJC-1295 stacked four substitutions onto the same 29-residue chain, and tesamorelin kept the full 44-residue chain with an N-terminal hexenoyl group. The family is compared side by side in a separate article.[6][3]

Continue reading:Sermorelin vs CJC-1295 vs tesamorelin

What did the Geref trials in children show?

Sermorelin's strongest clinical data come from children with growth-hormone deficiency. In an open-label multicentre study, 110 previously untreated prepubertal GH-deficient children received sermorelin once daily at bedtime for up to a year, and 86 were eligible for the efficacy analysis. Mean height velocity rose from 4.1 cm per year at baseline to 8.0 cm per year at six months and 7.2 cm per year at twelve months, 74% were rated good responders at six months, bone age did not advance faster than height age, and no adverse changes in chemistry, glucose or IGF-1 were seen.[9]

The comparison with growth hormone itself is less flattering. In a randomised study of 60 children with GH deficiency of hypothalamic origin, six months of continuous GHRH(1-29)-NH2 at either of two doses produced mean height velocities of 9.2 and 9.3 cm per year, against 14.6 cm per year with GH. IGF-1 rose at first and then fell back, and 39 of the 40 children given GHRH developed antibodies to it, which had almost disappeared nine months after treatment stopped.[10]

A 1999 drug review summarised the position: limited data showed once-daily sermorelin was effective in some prepubertal children with idiopathic GH deficiency, the sermorelin regimens compared directly with once-daily somatropin gave smaller gains in height velocity, and its effect on final adult height had not been determined.[8]

How was sermorelin used as a diagnostic test?

Because it acts directly on the pituitary, a single intravenous dose of sermorelin became a rapid and relatively specific test of the gland's capacity to release GH. Fewer children without GH deficiency gave false-positive results with sermorelin than with other provocative tests, and in adults the combination of sermorelin with arginine was considered more specific still.[8]

The test had a built-in blind spot. A normal GH response to sermorelin shows that the pituitary works, so it cannot exclude GH deficiency caused by a problem higher up, in the hypothalamus; other stimulation tests were needed to confirm that diagnosis.[8]

The arginine-plus-GHRH test disappeared with the product. An FDA medical review from 2017 records that Geref (sermorelin acetate) was withdrawn from the US market in 2008 because of a business decision by the manufacturer, as the active ingredient used to produce the diagnostic was no longer being made. The same review describes Geref as an amidated synthetic peptide corresponding to the first 29 amino acids of the 44-amino-acid GHRH.[15]

Does sermorelin work in adults?

It raises GH in older adults; whether that turns into anything more is unproven. In a study of ten healthy older men who took two dose levels in random order, 14 days of twice-daily GHRH(1-29) at the higher dose raised 24-hour GH and IGF-1 to the levels of nine young men, without changing fasting glucose or blood pressure.[11]

A single nightly dose did less. Eleven healthy men aged 64 to 76, with low baseline IGF-1, self-administered GHRH(1-29) each night for six weeks in an uncontrolled study. Nocturnal GH release and peak amplitude increased, but IGF-1, IGFBP-3, weight, DEXA measures of muscle and fat, glucose and lipids did not change. Two of six strength measures and one endurance test improved, and the authors concluded that single nightly doses are less effective than multiple daily doses.[12]

A close analogue, [Nle27]GHRH(1-29)-NH2, given nightly for 16 weeks after a placebo run-in to 19 men and women aged 55 to 71, raised nocturnal GH and IGF-1 within two weeks, but IGF-1 drifted back toward baseline by week 16. A retrospective chart review of 14 men prescribed sermorelin together with GHRP-2 and GHRP-6 reported higher IGF-1, but it had no control group and cannot isolate sermorelin's effect.[13][14]

Continue reading:Explore the healthy-ageing goal

What side effects were reported with sermorelin?

In the clinical programme, single intravenous doses and repeated once-daily subcutaneous doses were well tolerated. Transient facial flushing and pain at the injection site were the most commonly reported adverse events. In the one-year paediatric study, no adverse changes appeared in general biochemistry or hormone panels, fasting glucose did not change, and IGF-1 was not generated in excess.[8][9]

Immunogenicity is the signal most often missed. In the randomised six-month comparison with growth hormone, 39 of the 40 children receiving continuous GHRH(1-29)-NH2 developed antibodies to it. The antibodies did not correlate with the change in height and had almost disappeared nine months after treatment stopped, but they show that the body can recognise this peptide as foreign.[10]

The safety record has clear limits. It comes from GH-deficient children and from small adult studies lasting days to weeks. There are no long-term safety data in healthy adults, and a 2026 endocrine review describes the human evidence for sermorelin outside its original indications as limited and largely indirect.[12][16]

Is sermorelin FDA-approved or authorised in the EU?

Not any more in the United States. Sermorelin acetate was FDA-approved and marketed as Geref for the evaluation and treatment of GH deficiency in children. According to an FDA medical review, the manufacturer told the agency in July and December 2008 that it was discontinuing production, and the approvals of the two new drug applications containing Geref were withdrawn in June 2009.[16][15]

In the European Union, a search of the EMA medicines database on 22 September 2026 returned no entry for sermorelin, so there is no centrally authorised sermorelin medicine and no European public assessment report.[17]

In sport, the WADA 2026 Prohibited List names sermorelin alongside CJC-1293, CJC-1295 and tesamorelin as a GHRH analogue under S2.2.4, growth hormone releasing factors. Substances in class S2 are prohibited at all times, in and out of competition.[18]

How Peptyds frames sermorelin

Peptyds supplies sermorelin as a lyophilised research peptide with a batch certificate of analysis, for in-vitro laboratory research only. We do not present it as an anti-ageing therapy, a growth-hormone replacement or a body-composition product.

The evidence is worth knowing precisely because it is unusual for this field: a molecule with a real regulatory history, randomised and open-label trials in GH-deficient children, a validated diagnostic role, and a handful of small adult studies. It is also plainly bounded: the paediatric trials used a clinical population, the adult studies were small and short, and no controlled trial in healthy adults has shown a durable benefit.[9][10][12][16]

Tesamorelin, the GHRH analogue with the most extensive modern trial record, has its own complete guide, and CJC-1295, the substituted 29-residue analogue usually paired with ipamorelin, is covered in the CJC-1295 + ipamorelin guide.[3][16]

Continue reading:Tesamorelin: the complete guideCJC-1295 + ipamorelin: the complete guide

Sources

  1. [01]
  2. [02]
  3. [03]
  4. [04]
  5. [05]
  6. [06]
  7. [07]
  8. [08]
  9. [09]
  10. [10]
  11. [11]
  12. [12]
  13. [13]
  14. [14]
  15. [15]
  16. [16]
  17. [17]
  18. [18]

Questions

What is sermorelin?

Sermorelin is a synthetic peptide identical to the first 29 amino acids of human growth-hormone-releasing hormone, with an amidated C-terminus. It acts on the pituitary's GHRH receptor and prompts the release of the body's own growth hormone.[3][8]

Does sermorelin work?

In GH-deficient children it increased growth velocity, though less than growth hormone itself in a randomised comparison. In older men it raised GH and, with twice-daily dosing, IGF-1 over two weeks, but a six-week nightly study found no change in IGF-1 or body composition. No controlled trial in healthy adults has shown a lasting benefit.[9][10][11][12]

What is the half-life of sermorelin?

A few minutes. During intravenous infusion in ten healthy men, its disappearance half-time was 4.3 minutes. The GH response outlasts the peptide: after an intravenous injection in healthy men, GH stayed elevated for about three hours.[6][7]

Is sermorelin the same as GRF 1-29 or CJC-1295?

Sermorelin and GRF 1-29 are two names for the same peptide. CJC-1295 is a different molecule: the same 29-residue chain with four substitutions (D-Ala2, Gln8, Ala15 and Leu27), and in its DAC form an added albumin-binding group.[3][16]

Why was Geref discontinued?

According to an FDA medical review, it was withdrawn from the US market in 2008 because of a business decision by the manufacturer, as the active ingredient was no longer being produced. The approvals of the two applications containing Geref were withdrawn in June 2009.[15]

Is sermorelin banned in sport?

Yes. The WADA 2026 Prohibited List names sermorelin as a GHRH analogue under S2.2.4, growth hormone releasing factors, a class that is prohibited at all times, in and out of competition.[18]

Educational content. Not medical advice.

Next step

Choose the route that matches how you read.